PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00736.1.g00250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family CO-like
Protein Properties Length: 787aa    MW: 86406.5 Da    PI: 10.101
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00736.1.g00250.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box16.51.8e-05260286430
                      zf-B_box   4 rkCpeHeekelqlfCedCqqllCedCl 30 
                                   r C+ ++ + ++l+C+ +  +lC+ C 
  Zmw_sc00736.1.g00250.1.am.mk 260 RPCDACGAEAARLYCRADAAFLCAGCX 286
                                   68************************7 PP

2CCT67.82.9e-23445488144
                           CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                   Rea+l+RY+eKrk+R+FeK+irY+sRKa+Ae+RpR+KGrF+k++
  Zmw_sc00736.1.g00250.1.am.mk 445 REARLMRYREKRKSRRFEKTIRYASRKAYAETRPRIKGRFAKRT 488
                                   9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.153257312IPR000315B-box-type zinc finger
CDDcd000214.72E-5260285No hitNo description
PROSITE profilePS5101716.876445487IPR010402CCT domain
PfamPF062032.9E-17445487IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 787 aa     Download sequence    Send to blast
MQPFSTTTTL AKYQSPEALD LQNVHDAIIL PLSVPPRAPI ADTAGEQPSR RPMEIRATSR  60
QPMARCHLFP RRLRRWEWDG RPPPTHGPPV PVASHNLPCL NARPIFLRQR PAFPHPARGR  120
RRCVNHRAYV PVGVGFYRLY RARSRGLDRS GEAGVRLGDG EARKAGTGKH GHWRTNSAPA  180
RRESDSRAPE TRSGSAQIRR GQRGRGSLAE NRFALSCPAA ATARYELHCR VRRCRQWRVI  240
AMAGDEKSSV GGSYWGLNTR PCDACGAEAA RLYCRADAAF LCAGCXXXXX XXXXXXXXXX  300
XXXXXXXXXX PVAPFYGSLA DAPKPFASSA AAAPKPGAAV DDDSSNEAEA ASWLLPEPDH  360
GQKDGSSAEV FFADSDTYLD LDFARSMDDV KAIGVQNCPP EMDLTGAKLF YPDHSVNHSV  420
SSSEAAVVPD AAAASAPVVS RGREREARLM RYREKRKSRR FEKTIRYASR KAYAETRPRI  480
KGRFAKRTSA VAGAGAEAEE EHDEEMYSSA AAAVAALLAP AAADVDYGVD GVVPTNYSLL  540
FGAVIYPPLR ALPACIARVH AKASYLYDYY DSTEAAMTSE LSLLPPIPTW KASPKAYADD  600
TSPALFIWAV RLCRNRGRDG LLVLCAQPSV PSDYPSERNR FVVDERGRAG KGRPWTTASY  660
PRRVACLGPR SSVRPARPTG GPHFCLRPPP LLAAADPFAC SVAESIRTSS AWLCPVRIVW  720
ATSAWLRDAR SSAAWHNGRV YARNGRARLV RTSAASRNRH VYTRNGRVIY AQNCRVYAQN  780
GCIHLPQ
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21913272